PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00059.235
Common NameAMTR_s00059p00206130, LOC18446035
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 336aa    MW: 37664.1 Da    PI: 6.8359
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00059.235genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.4e-32136189255
                                   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                               pr+rWt++LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  evm_27.model.AmTr_v1.0_scaffold00059.235 136 PRMRWTTTLHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 189
                                               9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.51E-15133190IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-28134190IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-23136189IPR006447Myb domain, plants
PfamPF002492.2E-7137188IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MDMRAGHVFP DLSLQISPPS QMDLEMAIEE AWHPLSRLSG DHIPTTNSGT SSENSQESPF  60
LLHHRLMMHM VSSDNDKASE FLGRGPNASF PFTDSFNGDA VILGLGSHHH LPALGRDFKR  120
NSRIMSCGSK RSMRAPRMRW TTTLHAHFVH AVELLGGHER ATPKSVLELM NVKDLTLAHV  180
KSHLQMYRTV KSTDKGAGQG PTEMGLRQRS RVSQPESGGF LRERANHFFS SENVPSHVVS  240
RGSWLDSLTK ENESIYSQAE TNQYTNLEVE VDKYKEASDS YHEEAEKWHS SSYPSPQLTS  300
SRLLSKLPNL EFTLGRESWQ NDYSETTSEL ALLKC*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006856223.10.0PREDICTED: probable transcription factor KAN4
SwissprotQ9FJV51e-52KAN4_ARATH; Probable transcription factor KAN4
TrEMBLU5D6300.0U5D630_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.18e-54G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]